HGH 191AA (Somatropin) Peptide

HGH 191AA (Somatropin) – Recombinant Human Growth Hormone Peptide for Research

Basic Information

• Product Name: HGH 191AA (Somatropin, Human Growth Hormone)

• CAS Number: 12629-01-5 (also referenced as 9002-72-6)

• Molecular Weight: ~22.1 kDa

• Appearance: White lyophilized powder

• Purity: ≥98% (HPLC)

• Amino Acid Sequence: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Overview
HGH 191AA (somatropin) is a recombinant peptide hormone identical to the endogenous human growth hormone (hGH) produced by the anterior pituitary gland. It consists of a single-chain polypeptide of 191 amino acid residues with a molecular weight of approximately 22 kDa. This peptide plays a fundamental role in stimulating growth, cell reproduction, and regeneration in humans and other animals. It is widely used in research on growth disorders, tissue repair, metabolism, and aging.

Mechanism of Action
HGH 191AA binds to growth hormone receptors (GHR) on target cells, activating intracellular signaling pathways such as JAK2/STAT5. This stimulates the liver and other tissues to produce insulin-like growth factor 1 (IGF-1), which mediates many of the growth-promoting effects. The peptide promotes protein synthesis, cell division, and tissue growth while regulating carbohydrate, lipid, and protein metabolism.

Key Benefits

• Stimulates growth and development in research models.

• Promotes protein synthesis and muscle tissue repair.

• Supports cell regeneration and tissue healing.

• Regulates metabolism and body composition.

• Enhances recovery and repair processes.

• Well-characterized recombinant peptide with established sequence.

Applications

• Growth and development research: Studies on growth hormone deficiency, dwarfism, and pediatric growth disorders.

• Tissue repair and regeneration: Investigated for muscle recovery, wound healing, and cartilage regeneration.

• Metabolic research: Explored for its role in fat metabolism, glucose homeostasis, and body composition.

• Aging research: Studies on age-related decline in growth hormone levels and potential interventions.

• Cell biology: Used in cell culture models to study proliferation, differentiation, and signaling pathways.

• Pharmacology: Employed in drug development and screening for growth hormone-related therapeutics.

Recommended Use
For research use only. Not for human therapeutic or diagnostic use. Typical in vitro concentrations and dosages should be determined based on specific study protocols.

Handling and Storage

• Store lyophilized powder at –20°C in tightly sealed containers, protected from light and moisture.

• After reconstitution, store at –80°C and avoid repeated freeze‑thaw cycles.

• Reconstitute in sterile water or suitable buffer as required.

• Use appropriate personal protective equipment (gloves, lab coat, safety goggles) when handling.

Packaging
Available in vials (e.g., 2 mg, 5 mg, 10 mg). Custom packaging upon request.

Quality Assurance
Each batch is tested for purity (by HPLC ≥98%), identity (by mass spectrometry), and sequence confirmation to ensure consistent quality.